PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006281t1
Common NameTCM_006281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family B3
Protein Properties Length: 456aa    MW: 52939.4 Da    PI: 4.9218
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006281t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.41.4e-149101197
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                       ffkv +p+ ++   r+++p + +   +g  + + t tl++ +g+   v+l  +k++gr++++kGW++F ++n +ke D++vF+++g s f  +
  Thecc1EG006281t1   9 FFKVYLPKLSF--ERMSIPPTAVVCSNGLMPMPATATLRNCKGQCRHVEL--NKCDGRMFFEKGWRRFIDDNSIKEEDILVFSYVGCSVFDVK 97 
                       67777444444..568***999754445556899****************..********************************998888777 PP

                       EEEE CS
                B3  94 vkvf 97 
                       v  f
  Thecc1EG006281t1  98 VYGF 101
                       7665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.8971102IPR003340B3 DNA binding domain
SuperFamilySSF1019369.61E-193104IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.4E-175103IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.4E-89102IPR003340B3 DNA binding domain
PfamPF023621.3E-129101IPR003340B3 DNA binding domain
CDDcd100176.22E-15999No hitNo description
SMARTSM010190.058271369IPR003340B3 DNA binding domain
SuperFamilySSF1019361.35E-9279370IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.4E-8282370IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MSNFEAKNFF KVYLPKLSFE RMSIPPTAVV CSNGLMPMPA TATLRNCKGQ CRHVELNKCD  60
GRMFFEKGWR RFIDDNSIKE EDILVFSYVG CSVFDVKVYG FDGCEKNVSY LVEKGESGEE  120
QGQEDDEEED YGYQEEGEDS VLEMEDDDDD DGYLEEGEDS DLEMKREEEN EEVLDTLTNR  180
RGQRKINKRN SGLHEGLAAV NDEETTSMEV EYEELNPERY VQELNPYFVA RTRLGRGNEL  240
IFLHYFDFLF SNIMFSHAPM PRMLVSLSGM FSTNFWLYSL CGSQYVPSTV IRDYDLILED  300
NQEITFLDPY DRKKIGKVRK WKDRRTCIIG WRSFCNRNRV NQERDVCICE FLLENENEQK  360
PKFMKVHIIR GKHTKSQKST LKHYQKKHSD KTLPGLTLYY SNQVQDASSL TMNSHGRGSN  420
RPTLQSLVSK LPCEKVDIEH RKGHEELSKS NCGLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007041352.10.0Uncharacterized protein isoform 1
TrEMBLA0A061E4N00.0A0A061E4N0_THECC; Uncharacterized protein isoform 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15612380
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.19e-14B3 family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]